Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AURKC Rabbit pAb (APR29761N)

Product Specifications

Background

This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AURKC Rabbit pAb (APR23451N7) .

Synonyms

AURKC; AIE2; AIK3; ARK3; AurC; HEL-S-90; SPGF5; STK13; aurora-C

Gene ID

6795

UniProt

Q9UQB9

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/33kDa/35kDa Observed MW: 36KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6795

Uniprot URL

https://www.uniprot.org/uniprot/Q9UQB9

AA Sequence

MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human iPSC-derived Keratinocytes
CSC-00840L One Frozen Vial

Human iPSC-derived Keratinocytes

Sign In for Pricing
View Details
3- (Fur-2-yl) aniline hydrochloride
OR7393-01 1 g

3- (Fur-2-yl) aniline hydrochloride

Sign In for Pricing
View Details
3- (Fur-2-yl) aniline hydrochloride
OR7393-02 5 g

3- (Fur-2-yl) aniline hydrochloride

Sign In for Pricing
View Details
PMEPA1 Recombinant Protein (Rat)
RP221114 100 µg

PMEPA1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Foxh1 (NM_007989) Mouse Untagged Clone
MC208468 10 µg

Foxh1 (NM_007989) Mouse Untagged Clone

Sign In for Pricing
View Details
ZNRF2 (m) -PR
sc-155814-PR 10 µM - 20 µL

ZNRF2 (m) -PR

Sign In for Pricing
View Details