Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPSF1 Rabbit pAb (APR29760N)

Product Specifications

Background

Cleavage and polyadenylation specificity factor (CPSF) is a multisubunit complex that plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly (A) synthesis. CPSF1 is the largest subunit of the CPSF complex (Murthy and Manley, 1995 [PubMed 7590244]) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CPSF1 Rabbit pAb (APR23540N4) .

Synonyms

CPSF1; CPSF160; HSU37012; P/cl.18

Gene ID

29894

UniProt

Q10570

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 160kDa Observed MW: 170kDa/185kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29894

Uniprot URL

https://www.uniprot.org/uniprot/Q10570

AA Sequence

LYRDLSGMFTTESRLGGARDELGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAEPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RASAL2 Protein
E30P64967A 50 µg

Recombinant Human RASAL2 Protein

Sign In for Pricing
View Details
HCG22 siRNA Oligos set (Human)
23085171 3x 5 nmol

HCG22 siRNA Oligos set (Human)

Sign In for Pricing
View Details
CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450 (PA) ) (MaxLight 405) discontinued
245145-ML405 100 µL

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450 (PA) ) (MaxLight 405) discontinued

Sign In for Pricing
View Details
H69AR cells
C0016046 One Frozen Vial

H69AR cells

Sign In for Pricing
View Details
Integrin αV (H-2) P
sc-376156 P 100 µg - 0.5 mL

Integrin αV (H-2) P

Sign In for Pricing
View Details
DGCR8 Antibody, mAb, Rabbit
A02916-50 50 µL

DGCR8 Antibody, mAb, Rabbit

Sign In for Pricing
View Details