Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT3 Rabbit pAb (APR29759N)

Product Specifications

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SIRT3 Rabbit pAb (APR29759N) .

Synonyms

SIRT3; SIR2L3; sirtuin 3

Gene ID

23410

UniProt

Q9NTG7

Cellular Locus

Mitochondrion matrix

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/43kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23410

Uniprot URL

https://www.uniprot.org/uniprot/Q9NTG7

AA Sequence

ERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEPLDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Trim32 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47770114 3x 1.0 µg

Trim32 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Biotin)
MBS6338262-01 0.2 mL

PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Biotin)

Ask
View Details
PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Biotin)
MBS6338262-02 5x 0.2 mL

PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Biotin)

Ask
View Details
Bovine CD47 Monoclonal Antibody (clone TH17A)
WS0556B 100 µg

Bovine CD47 Monoclonal Antibody (clone TH17A)

Ask
View Details
Mouse COPG1 shRNA Plasmid
abx974435-01 150 µg

Mouse COPG1 shRNA Plasmid

Ask
View Details
Mouse COPG1 shRNA Plasmid
abx974435-02 300 µg

Mouse COPG1 shRNA Plasmid

Ask
View Details