Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP2 Rabbit pAb (APR29756N)

Product Specifications

Background

This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality REEP2 Rabbit pAb (APR23544N2) .

Synonyms

REEP2; C5orf19; SGC32445; SPG72; Yip2d

Gene ID

51308

UniProt

Q9BRK0

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51308

Uniprot URL

https://www.uniprot.org/uniprot/Q9BRK0

AA Sequence

HPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

delta-Buthitoxin-Hj2a
MBS5822091 Inquire

delta-Buthitoxin-Hj2a

Ask
View Details
Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) ) (BSA & Azide Free)
168818-AF 100 µg

Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) ) (BSA & Azide Free)

Ask
View Details
Rat Centromere protein S (APITD1) ELISA Kit
MBS7233654-01 48 Well

Rat Centromere protein S (APITD1) ELISA Kit

Ask
View Details
Rat Centromere protein S (APITD1) ELISA Kit
MBS7233654-02 96 Well

Rat Centromere protein S (APITD1) ELISA Kit

Ask
View Details
Rat Centromere protein S (APITD1) ELISA Kit
MBS7233654-03 5x 96 Well

Rat Centromere protein S (APITD1) ELISA Kit

Ask
View Details
Rat Centromere protein S (APITD1) ELISA Kit
MBS7233654-04 10x 96 Well

Rat Centromere protein S (APITD1) ELISA Kit

Ask
View Details