Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX1 Rabbit pAb (APR29739N)

Product Specifications

Background

This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOX1 Rabbit pAb (APR23537N7) .

Synonyms

NOX1; GP91-2; MOX1; NOH-1; NOH1

Gene ID

27035

UniProt

Q9Y5S8

Cellular Locus

Cell projection, Multi-pass membrane protein, invadopodium membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/58kDa/64kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27035

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5S8

AA Sequence

KSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pesticide Std Phosphamidon Neat - 10MG
REPET400N 10 mg

Pesticide Std Phosphamidon Neat - 10MG

Sign In for Pricing
View Details
CD20 Polyclonal Antibody
BT-AP01399-01 20 µL

CD20 Polyclonal Antibody

Sign In for Pricing
View Details
CD20 Polyclonal Antibody
BT-AP01399-02 50 µL

CD20 Polyclonal Antibody

Sign In for Pricing
View Details
CD20 Polyclonal Antibody
BT-AP01399-03 100 µL

CD20 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ADAMTS5 Antibody Picoband®, FITC Conjugate
A02802-1-FITC 100 µg/Vial

Anti-ADAMTS5 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Mier2 shRNA (UAS) - Lentiviral mouse Mier2 shRNA (UAS, iRFP) (25)
GTR15241970 1 Vial

Lentiviral mouse Mier2 shRNA (UAS) - Lentiviral mouse Mier2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details