Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPX Rabbit pAb (APR29729N)

Product Specifications

Background

The protein encoded by this gene is part of a protease found in mitochondria. This protease is ATP-dependent and targets specific proteins for degradation. The protease consists of two heptameric rings of the CLPP catalytic subunit sandwiched between two hexameric rings of the chaperone subunit encoded by this gene. Targeted proteins are unwound by this protein and then passed on to the CLPP subunit for degradation. Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLPX Rabbit pAb (APR23514N8) .

Synonyms

CLPX

Gene ID

10845

UniProt

O76031

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 69kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10845

Uniprot URL

https://www.uniprot.org/uniprot/O76031

AA Sequence

LPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Harmol Hydrochloride
TRC-H105263-2.5G 2.5 g

Harmol Hydrochloride

Sign In for Pricing
View Details
Rat CAP1 shRNA Plasmid
abx986172-01 150 µg

Rat CAP1 shRNA Plasmid

Sign In for Pricing
View Details
Rat CAP1 shRNA Plasmid
abx986172-02 300 µg

Rat CAP1 shRNA Plasmid

Sign In for Pricing
View Details
Anti-Apg3/ATG3 Antibody Picoband® Fluoro488 Conjugated
A01768-1-Fluoro488 100 µg/Vial

Anti-Apg3/ATG3 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
GIT2 (ARF GTPase-activating Protein GIT2, ARF GAP GIT2, Cool-interacting Tyrosine-phosphorylated Protein 2, CAT-2, CAT2, G-Protein-coupled Receptor Kinase-interactor 2, GRK-interacting Protein 2, KIAA0148) (MaxLight 490)
MBS6201006-01 0.1 mL

GIT2 (ARF GTPase-activating Protein GIT2, ARF GAP GIT2, Cool-interacting Tyrosine-phosphorylated Protein 2, CAT-2, CAT2, G-Protein-coupled Receptor Kinase-interactor 2, GRK-interacting Protein 2, KIAA0148) (MaxLight 490)

Sign In for Pricing
View Details
GIT2 (ARF GTPase-activating Protein GIT2, ARF GAP GIT2, Cool-interacting Tyrosine-phosphorylated Protein 2, CAT-2, CAT2, G-Protein-coupled Receptor Kinase-interactor 2, GRK-interacting Protein 2, KIAA0148) (MaxLight 490)
MBS6201006-02 5x 0.1 mL

GIT2 (ARF GTPase-activating Protein GIT2, ARF GAP GIT2, Cool-interacting Tyrosine-phosphorylated Protein 2, CAT-2, CAT2, G-Protein-coupled Receptor Kinase-interactor 2, GRK-interacting Protein 2, KIAA0148) (MaxLight 490)

Sign In for Pricing
View Details