Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D5 Rabbit pAb (APR29726N)

Product Specifications

Background

May act as a GTPase-activating protein (GAP for Rab family protein (s. May act as a GAP for RAB7A. Can displace RAB7A and retromer CSC subcomplex from the endosomal membrane to the cytosol; at least retromer displacement seems to require its catalytic activity. Required for retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN; the function seems to require its catalytic activity. Involved in regulation of autophagy. May act as a molecular switch between endosomal and autophagosomal transport and is involved in reprogramming vesicle trafficking upon autophagy induction. Involved in the trafficking of ATG9A upon activation of autophagy. May regulate the recruitment of ATG9A-AP2-containing vesicles to autophagic membranes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TBC1D5 Rabbit pAb (APR23496N9) .

Synonyms

TBC1D5

Gene ID

9779

UniProt

Q92609

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 89kDa/91kDa Observed MW: 91kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9779

Uniprot URL

https://www.uniprot.org/uniprot/Q92609

AA Sequence

NAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSSSSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSATKKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLEKEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQASSETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASSSNPSSSPDDDSSKDSGFTIVSPLDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPIC activation kit by CRISPRa
GA114757 1 Kit

Human SPIC activation kit by CRISPRa

Sign In for Pricing
View Details
SLFN13 Antibody
DF15121-01 100 µL

SLFN13 Antibody

Sign In for Pricing
View Details
SLFN13 Antibody
DF15121-02 200 µL

SLFN13 Antibody

Sign In for Pricing
View Details
RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (MaxLight 550)
MBS6342771-01 0.1 mL

RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (MaxLight 550)

Sign In for Pricing
View Details
RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (MaxLight 550)
MBS6342771-02 5x 0.1 mL

RNF19A, ID (RNF19A, RNF19, E3 ubiquitin-protein ligase RNF19A, Double ring-finger protein, RING finger protein 19A, p38) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Olfactory receptor 4F5 (OR4F5) ELISA Kit
MBS7223346-01 48 Well

Mouse Olfactory receptor 4F5 (OR4F5) ELISA Kit

Sign In for Pricing
View Details