Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GORAB Rabbit pAb (APR29710N)

Product Specifications

Background

This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GORAB Rabbit pAb (APR23587N5) .

Synonyms

GORAB; GO; NTKLBP1; SCYL1BP1

Gene ID

92344

UniProt

Q5T7V8

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/24kDa/27kDa/44kDa Observed MW: 55kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=92344

Uniprot URL

https://www.uniprot.org/uniprot/Q5T7V8

AA Sequence

MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PIN1 shRNA (UAS) - Lentiviral human PIN1 shRNA (UAS, GFP) plasmid
GTR15312829 1 Vial

Lentiviral human PIN1 shRNA (UAS) - Lentiviral human PIN1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Integrin alpha 2/CD49b Antibody (HAS-4) [mFluor Violet 450 SE]
NB100-2608MFV450 0.1 mL

Mouse Monoclonal Integrin alpha 2/CD49b Antibody (HAS-4) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mouse Npc2 Pre-designed siRNA Set A
SI109508A 1 Each

Mouse Npc2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
POLR2H, ID (POLR2H, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit H, DNA-directed RNA polymerases I, II, and III 17.1kD polypeptide, RPB17, RPB8 homolog)
040261 200 µL

POLR2H, ID (POLR2H, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit H, DNA-directed RNA polymerases I, II, and III 17.1kD polypeptide, RPB17, RPB8 homolog)

Sign In for Pricing
View Details
TCF19 Rabbit pAb
A6147-01 20 µL

TCF19 Rabbit pAb

Sign In for Pricing
View Details
TCF19 Rabbit pAb
A6147-02 100 μL

TCF19 Rabbit pAb

Sign In for Pricing
View Details