Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAML2 Rabbit pAb (APR29707N)

Product Specifications

Background

The protein encoded by this gene is a member of the Mastermind-like family of proteins. All family members are proline and glutamine-rich, and contain a conserved basic domain that binds the ankyrin repeat domain of the intracellular domain of the Notch receptors (ICN1-4) in their N-terminus, and a transcriptional activation domain in their C-terminus. This protein binds to an extended groove that is formed by the interaction of CBF1, Suppressor of Hairless, LAG-1 (CSL) with ICN, and positively regulates Notch signaling. High levels of expression of this gene have been observed in several B cell-derived lymphomas. Translocations resulting in fusion proteins with both CRTC1 and CRTC3 have been implicated in the development of mucoepidermoid carcinomas, while a translocation event with CXCR4 has been linked with chronic lymphocytic leukemia (CLL) . Copy number variation in the polyglutamine tract has been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAML2 Rabbit pAb (APR23574N5) .

Synonyms

MAML2; MAM-3; MAM2; MAM3; MLL-MAML2

Gene ID

84441

UniProt

Q8IZL2

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 150kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84441

Uniprot URL

https://www.uniprot.org/uniprot/Q8IZL2

AA Sequence

NQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHISA5 Protein Vector (Mouse) (pPM-C-His)
PV229029 500 ng

SHISA5 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
FOXG1 Antibody
CSB-PA008815GA01HU 100 µL

FOXG1 Antibody

Sign In for Pricing
View Details
NDST4 Rabbit Polyclonal Antibody (Fluoro647)
orb3095087 100 µg

NDST4 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Anti-Interleukin-7 IL7 Antibody Picoband®, FITC Conjugate
PA1467-FITC 100 µg/Vial

Anti-Interleukin-7 IL7 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
HIF1A, CT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8)
036549 200 µL

HIF1A, CT (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8)

Sign In for Pricing
View Details
AMICA1, NT (AMICA1, JAML, Junctional adhesion molecule-like, Adhesion molecule interacting with CXADR antigen 1, Dendritic cell-specific protein CREA7-1) (MaxLight 650) discontinued
031836-ML650 100 µL

AMICA1, NT (AMICA1, JAML, Junctional adhesion molecule-like, Adhesion molecule interacting with CXADR antigen 1, Dendritic cell-specific protein CREA7-1) (MaxLight 650) discontinued

Sign In for Pricing
View Details