Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAML2 Rabbit pAb (APR29707N)

Product Specifications

Background

The protein encoded by this gene is a member of the Mastermind-like family of proteins. All family members are proline and glutamine-rich, and contain a conserved basic domain that binds the ankyrin repeat domain of the intracellular domain of the Notch receptors (ICN1-4) in their N-terminus, and a transcriptional activation domain in their C-terminus. This protein binds to an extended groove that is formed by the interaction of CBF1, Suppressor of Hairless, LAG-1 (CSL) with ICN, and positively regulates Notch signaling. High levels of expression of this gene have been observed in several B cell-derived lymphomas. Translocations resulting in fusion proteins with both CRTC1 and CRTC3 have been implicated in the development of mucoepidermoid carcinomas, while a translocation event with CXCR4 has been linked with chronic lymphocytic leukemia (CLL) . Copy number variation in the polyglutamine tract has been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAML2 Rabbit pAb (APR23574N5) .

Synonyms

MAML2; MAM-3; MAM2; MAM3; MLL-MAML2

Gene ID

84441

UniProt

Q8IZL2

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 150kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84441

Uniprot URL

https://www.uniprot.org/uniprot/Q8IZL2

AA Sequence

NQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SDF-1α/CXCL12α
P6537-100μg 100 µg

Recombinant Human SDF-1α/CXCL12α

Sign In for Pricing
View Details
Rabbit Polyclonal DLC1/DLEC1 Antibody [mFluor Violet 610 SE]
NBP3-06065MFV610 0.1 mL

Rabbit Polyclonal DLC1/DLEC1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
PFKFB2 (D5I5F) Rabbit Monoclonal Antibody
CST 13029S 100 µL

PFKFB2 (D5I5F) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PAGE5, CT (PAGE5, GAGEE1, G antigen family E member 1, Cancer/testis antigen 16.1, Prostate-associated gene 5 protein)
039616 200 µL

PAGE5, CT (PAGE5, GAGEE1, G antigen family E member 1, Cancer/testis antigen 16.1, Prostate-associated gene 5 protein)

Sign In for Pricing
View Details
MDM2, phosphorylated (Thr218) (Ubiquitin-protein Ligase E3 Mdm2, p53-binding Protein Mdm2, Oncoprotein Mdm2, Double Minute 2 Protein, Hdm2) (Azide free) (HRP) discontinued
M2800-04E-HRP 200 µL

MDM2, phosphorylated (Thr218) (Ubiquitin-protein Ligase E3 Mdm2, p53-binding Protein Mdm2, Oncoprotein Mdm2, Double Minute 2 Protein, Hdm2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
(20S) -4,4,20-Trimethyl-21-[[tris (isopropyl) silyl]oxy]-pregn-5-en-3-one-d6
160106 2.5 mg

(20S) -4,4,20-Trimethyl-21-[[tris (isopropyl) silyl]oxy]-pregn-5-en-3-one-d6

Sign In for Pricing
View Details