Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUK Rabbit pAb (APR29698N)

Product Specifications

Background

The protein encoded by this gene belongs to the GHMP (galacto-, homoserine, mevalonate and phosphomevalonate) kinase family and catalyzes the phosphorylation of L-fucose to form beta-L-fucose 1-phosphate. This enzyme catalyzes the first step in the utilization of free L-fucose in glycoprotein and glycolipid synthesis. L-fucose may be important in mediating a number of cell-cell interactions such as blood group antigen recognition, inflammation, and metastatis. While several transcript variants may exist for this gene, the full-length nature of only one has been described to date.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FUK Rabbit pAb (APR23594N8) .

Synonyms

FUK; 1110046B12Rik

Gene ID

197258

UniProt

Q8N0W3

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 117kDa/118kDa Observed MW: 117kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=197258

Uniprot URL

https://www.uniprot.org/uniprot/Q8N0W3

AA Sequence

LLKAAFICAGIVHVHSELQLSEQLLRTFGGGFELHTWSELPHGSGLGTSSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRSRAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLLQDVLRSWYARLPAVVQNAHSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQKKLMAPGCEPLTVRRMMDVLAPHVHGQSLAGAGGGGFLYLLTKEPQQKEALEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTCCPFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti- Bombesin Receptor Subtype 3 (BRS3) Antibody
GWB-19B153 0.05 mg

Anti- Bombesin Receptor Subtype 3 (BRS3) Antibody

Sign In for Pricing
View Details
Chrna1 Mouse shRNA Lentiviral Particle (Locus ID 11435)
TL500016V 500 µL Each

Chrna1 Mouse shRNA Lentiviral Particle (Locus ID 11435)

Sign In for Pricing
View Details
OR2Z1 (NM_001004699) Human Untagged Clone
SC300742 10 µg

OR2Z1 (NM_001004699) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral human RBP3 shRNA (UAS) - Lentiviral human RBP3 shRNA (UAS) (25)
GTR15145745 1 Vial

Lentiviral human RBP3 shRNA (UAS) - Lentiviral human RBP3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Porcine Neurotrophin 3 (NT3) ELISA Kit
YP-W200242-01 48 Tests

Porcine Neurotrophin 3 (NT3) ELISA Kit

Sign In for Pricing
View Details
Porcine Neurotrophin 3 (NT3) ELISA Kit
YP-W200242-02 96 Tests

Porcine Neurotrophin 3 (NT3) ELISA Kit

Sign In for Pricing
View Details