Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3S2 Rabbit pAb (APR29656N)

Product Specifications

Background

Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AP3S2 Rabbit pAb (APR23824N7) .

Synonyms

AP3S2; AP3S3; sigma3b

Gene ID

10239

UniProt

P59780

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/22kDa/43kDa Observed MW: 22kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10239

Uniprot URL

https://www.uniprot.org/uniprot/P59780

AA Sequence

MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tumor Necrosis Factor Receptor Type 1
7-01669 5 µg

Recombinant Human Tumor Necrosis Factor Receptor Type 1

Sign In for Pricing
View Details
Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)
MBS1100167-01 0.02 mg (E-Coli)

Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)
MBS1100167-02 0.1 mg (E-Coli)

Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)
MBS1100167-03 0.02 mg (Yeast)

Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)
MBS1100167-04 0.1 mg (Yeast)

Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details
Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)
MBS1100167-05 0.02 mg (Baculovirus)

Recombinant Enterobacter sp. GTP cyclohydrolase 1 (folE)

Sign In for Pricing
View Details