Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] Prion Protein Rabbit pAb (APR29603N)

Product Specifications

Background

The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Prion Protein Rabbit pAb (APR24178N8) .

Synonyms

PRNP; ASCR; AltPrP; CD230; CJD; GSS; KURU; PRIP; PrP; PrP27-30; PrP33-35C; PrPc; p27-30

Gene ID

5621

UniProt

P04156

Cellular Locus

Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Lipid-anchor, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa/26kDa/27kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5621

Uniprot URL

https://www.uniprot.org/uniprot/P04156

AA Sequence

KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RPA p70 Antibody, mAb, Rabbit
A04004-50 50 µL

RPA p70 Antibody, mAb, Rabbit

Ask
View Details
VSX1, ID (VSX1, RINX, Visual system homeobox 1, Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Transcription factor VSX1) (Biotin)
MBS6362886-01 0.2 mL

VSX1, ID (VSX1, RINX, Visual system homeobox 1, Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Transcription factor VSX1) (Biotin)

Ask
View Details
VSX1, ID (VSX1, RINX, Visual system homeobox 1, Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Transcription factor VSX1) (Biotin)
MBS6362886-02 5x 0.2 mL

VSX1, ID (VSX1, RINX, Visual system homeobox 1, Homeodomain protein RINX, Retinal inner nuclear layer homeobox protein, Transcription factor VSX1) (Biotin)

Ask
View Details
EGR3 Protein (N-His, Human)
P503527 100 µg

EGR3 Protein (N-His, Human)

Ask
View Details
Rat Melanoma-Derived Growth Regulatory Protein (MIA) Protein
abx167946-01 10 µg

Rat Melanoma-Derived Growth Regulatory Protein (MIA) Protein

Ask
View Details
Rat Melanoma-Derived Growth Regulatory Protein (MIA) Protein
abx167946-02 50 µg

Rat Melanoma-Derived Growth Regulatory Protein (MIA) Protein

Ask
View Details