Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] 14-3-3 sigma Rabbit pAb (APR29581N)

Product Specifications

Background

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] 14-3-3 sigma Rabbit pAb (APR24154N1) .

Synonyms

SFN; YWHAS; stratifin

Gene ID

2810

UniProt

P31947

Cellular Locus

Cytoplasm, Nucleus, Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/27kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2810

Uniprot URL

https://www.uniprot.org/uniprot/P31947

AA Sequence

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF9, Recombinant, Human, His-Tag, AVI-Tag discontinued
590636-01 20 µg

TNFSF9, Recombinant, Human, His-Tag, AVI-Tag discontinued

Sign In for Pricing
View Details
TNFSF9, Recombinant, Human, His-Tag, AVI-Tag discontinued
590636-02 100 µg

TNFSF9, Recombinant, Human, His-Tag, AVI-Tag discontinued

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Polyclonal Antibody
CAU33449-01 100 µL

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Polyclonal Antibody

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Polyclonal Antibody
CAU33449-02 200 µL

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Polyclonal Antibody

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Polyclonal Antibody
CAU33449-03 1 mL

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Polyclonal Antibody

Sign In for Pricing
View Details
ACOT6 Rabbit Polyclonal Antibody
orb624449-01 50 µg

ACOT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details