Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Α-Tubulin Rabbit pAb (APR28866N)

Product Specifications

Background

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality α-Tubulin Rabbit pAb (APR28866N) .

Synonyms

TUBA4A; ALS22; H2-ALPHA; TUBA1

Gene ID

7277

UniProt

P68366

Cellular Locus

Cytoplasm, cytoskeleton

Applications

WB (Homo sapiens, Mus musculus, Sus scrofa, Brachyura) Co-IP (Homo sapiens)

Dilution

WB 1:2000 - 1:10000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7277

Uniprot URL

https://www.uniprot.org/uniprot/P68366

AA Sequence

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Albumin Antibody (188835) [Biotin]
FAB1455B 0.1 mL

Mouse Monoclonal Albumin Antibody (188835) [Biotin]

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1A) (NM_139250) Human Tagged ORF Clone
RC216285 10 µg

NY-ESO-1 (CTAG1A) (NM_139250) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os01g0276800 Polyclonal Antibody
MBS9017067 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os01g0276800 Polyclonal Antibody

Sign In for Pricing
View Details
Goat Synaptopodin ELISA Kit
MBS739594-01 48 Well

Goat Synaptopodin ELISA Kit

Sign In for Pricing
View Details
Goat Synaptopodin ELISA Kit
MBS739594-02 96 Well

Goat Synaptopodin ELISA Kit

Sign In for Pricing
View Details
Goat Synaptopodin ELISA Kit
MBS739594-03 5x 96 Well

Goat Synaptopodin ELISA Kit

Sign In for Pricing
View Details