Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Α-Tubulin Rabbit pAb (APR28866N)

Product Specifications

Background

Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality α-Tubulin Rabbit pAb (APR28866N) .

Synonyms

TUBA4A; ALS22; H2-ALPHA; TUBA1

Gene ID

7277

UniProt

P68366

Cellular Locus

Cytoplasm, cytoskeleton

Applications

WB (Homo sapiens, Mus musculus, Sus scrofa, Brachyura) Co-IP (Homo sapiens)

Dilution

WB 1:2000 - 1:10000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7277

Uniprot URL

https://www.uniprot.org/uniprot/P68366

AA Sequence

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PTGER3 (Prostaglandin E Receptor 3) ELISA Kit
EM2140 96 Tests

Mouse PTGER3 (Prostaglandin E Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Plpp2 (NM_015817) Mouse Tagged Lenti ORF Clone
MR203710L3 10 µg

Plpp2 (NM_015817) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Btd (NM_001012047) Rat Tagged Lenti ORF Clone
RR201713L3 10 µg

Btd (NM_001012047) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Calcium binding protein P22 (CHP1) Human qPCR Primer Pair (NM_007236)
HP209998 200 Reactions

Calcium binding protein P22 (CHP1) Human qPCR Primer Pair (NM_007236)

Sign In for Pricing
View Details
Human Cytochrome P450 3A4 (CYP3A4) ELISA Kit
RDR-CYP3A4-Hu-48Tests 48 Tests

Human Cytochrome P450 3A4 (CYP3A4) ELISA Kit

Sign In for Pricing
View Details
Rat CLDN5 (Claudin 5) ValidElisa Kit
EK342797 96 Well

Rat CLDN5 (Claudin 5) ValidElisa Kit

Sign In for Pricing
View Details