Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Β-Tubulin Rabbit pAb (APR28865N)

Product Specifications

Background

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality β-Tubulin Rabbit pAb (APR28865N) .

Synonyms

CDCBM6; CSCSC1; M40; OK/SW-cl.56; TUBB1; TUBB5; Beta Tubulin; TUBB; β-Tubulin

Gene ID

203068

UniProt

P07437

Cellular Locus

Cytoplasm, cytoskeleton

Applications

WB (Homo sapiens, Mus musculus, Rattus norvegicus, Bos taurus) IP (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=203068

Uniprot URL

https://www.uniprot.org/uniprot/P07437

AA Sequence

SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV2-CMV-RRM1-3xFLAG-Puro Plasmid
PVT70357 2 µg

PLV2-CMV-RRM1-3xFLAG-Puro Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal CD151 Antibody (B-E31) [DyLight 650]
NBP3-18100C 0.1 mL

Mouse Monoclonal CD151 Antibody (B-E31) [DyLight 650]

Sign In for Pricing
View Details
P27Kip1, phosphorylated (T170) (CDKN1B, KIP1, Cyclin-dependent kinase inhibitor 1B, Cyclin-dependent kinase inhibitor p27, p27Kip1) (MaxLight 405) discontinued
039572-ML405 100 µL

P27Kip1, phosphorylated (T170) (CDKN1B, KIP1, Cyclin-dependent kinase inhibitor 1B, Cyclin-dependent kinase inhibitor p27, p27Kip1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FABP3 (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (MaxLight 405)
MBS6190077-01 0.1 mL

FABP3 (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (MaxLight 405)

Sign In for Pricing
View Details
FABP3 (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (MaxLight 405)
MBS6190077-02 5x 0.1 mL

FABP3 (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (MaxLight 405)

Sign In for Pricing
View Details
2-Benzotriazol-1-yl-acetamide
264163-01 500 mg

2-Benzotriazol-1-yl-acetamide

Sign In for Pricing
View Details