Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Β-Tubulin Rabbit pAb (APR28865N)

Product Specifications

Background

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality β-Tubulin Rabbit pAb (APR28865N) .

Synonyms

CDCBM6; CSCSC1; M40; OK/SW-cl.56; TUBB1; TUBB5; Beta Tubulin; TUBB; β-Tubulin

Gene ID

203068

UniProt

P07437

Cellular Locus

Cytoplasm, cytoskeleton

Applications

WB (Homo sapiens, Mus musculus, Rattus norvegicus, Bos taurus) IP (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=203068

Uniprot URL

https://www.uniprot.org/uniprot/P07437

AA Sequence

SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FoxP1 Antibody (rFOXP1/6902) [Alexa Fluor 532]
NBP3-14022AF532 0.1 mL

Mouse Monoclonal FoxP1 Antibody (rFOXP1/6902) [Alexa Fluor 532]

Sign In for Pricing
View Details
ATOH8 Peptide
MBS152461-01 0.05 mg

ATOH8 Peptide

Sign In for Pricing
View Details
ATOH8 Peptide
MBS152461-02 5x 0.05 mg

ATOH8 Peptide

Sign In for Pricing
View Details
LentimiRa-mmu-miR-361-3p Vector
mm41371 500 ng

LentimiRa-mmu-miR-361-3p Vector

Sign In for Pricing
View Details
Rabbit FK506 binding protein 6, 36kDa (FKBP6) ELISA Kit
MBS2613376-01 48 Well

Rabbit FK506 binding protein 6, 36kDa (FKBP6) ELISA Kit

Sign In for Pricing
View Details
Rabbit FK506 binding protein 6, 36kDa (FKBP6) ELISA Kit
MBS2613376-02 96 Well

Rabbit FK506 binding protein 6, 36kDa (FKBP6) ELISA Kit

Sign In for Pricing
View Details