Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2Q2 Rabbit pAb (APR28831N)

Product Specifications

Background

Ube2Q2 is an E2 enzyme, which is part of the E1, E2, and E3 cascade responsible for ubiquitination of protein substrates. Ube2Q2 is thought to play a key role in regulating mitotic stages in cells. Its discovery was in connection with an arrest in the mitotic cell cycle. Inactivating this E2 prohibits the cell from continuing on past prophase. In cases of head and neck squamou cell carcinaoma, there is an elevated level of Ube2Q2 in the cancerous tissues. Also when the expression levels decreased, the cancerous cells were found to have a resistance to chemotherapeutic agents.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2Q2 Rabbit pAb (APR28831N) .

Synonyms

UBE2Q2

Gene ID

92912

UniProt

Q8WVN8

Cellular Locus

Cytoplasm

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/38kDa/40kDa/42kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=92912

Uniprot URL

https://www.uniprot.org/uniprot/Q8WVN8

AA Sequence

MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Rab11 family-interacting protein 3
E15820h 96 Tests

ELISA Kit For Rab11 family-interacting protein 3

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Scarecrow-like protein 7 (SCL7) , partial
MBS1422147 Inquire

Recombinant Arabidopsis thaliana Scarecrow-like protein 7 (SCL7) , partial

Sign In for Pricing
View Details
β-Lipoprotein, Low Density (LDL, Beta Lipoprotein) discontinued
L2601-10F 1 mL

β-Lipoprotein, Low Density (LDL, Beta Lipoprotein) discontinued

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH), partial
MBS7099531 Inquire

Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH), partial

Sign In for Pricing
View Details
KHDRBS3 Protein Vector (Human) (pPM-C-HA)
25507021 500 ng

KHDRBS3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr669 ORF Vector (Mouse) (pORF)
33348014 1.0 µg DNA

Olfr669 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details