Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM2 Rabbit pAb (APR28817N)

Product Specifications

Background

This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality JAM2 Rabbit pAb (APR28817N) .

Synonyms

JAM2; C21orf43; CD322; JAM-B; JAMB; PRO245; VE-JAM; VEJAM

Gene ID

58494

UniProt

P57087

Cellular Locus

Cell junction, Cell membrane, Single-pass type I membrane protein, tight junction

Applications

IP (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/33kDa/34kDa Observed MW: 33KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=58494

Uniprot URL

https://www.uniprot.org/uniprot/P57087

AA Sequence

FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Robenacoxib (Standard)
BA5941-5 5 mg

Robenacoxib (Standard)

Sign In for Pricing
View Details
C3orf33 Recombinant Protein (Human)
RP004768 100 µg

C3orf33 Recombinant Protein (Human)

Sign In for Pricing
View Details
Bovine Age related maculopathy susceptibility protein 2 (ARMS2) ELISA kit
GTR10427324 96 Well

Bovine Age related maculopathy susceptibility protein 2 (ARMS2) ELISA kit

Sign In for Pricing
View Details
500 Stamped ear tags, numbers 7,501 to 8,000
TAGS7501-8000 1 Each

500 Stamped ear tags, numbers 7,501 to 8,000

Sign In for Pricing
View Details
Caspase 3 Activity Assay Kit
C1116 100 Tests

Caspase 3 Activity Assay Kit

Sign In for Pricing
View Details
RAB27A / RAB27 (1-221, His-tag) Human Protein
AR09466PU-N 100 µg

RAB27A / RAB27 (1-221, His-tag) Human Protein

Sign In for Pricing
View Details