Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA9 Rabbit pAb (APR28814N)

Product Specifications

Background

This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHRNA9 Rabbit pAb (APR28814N) .

Synonyms

CHRNA9; HSA243342; NACHRA9

Gene ID

55584

UniProt

Q9UGM1

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 54kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55584

Uniprot URL

https://www.uniprot.org/uniprot/Q9UGM1

AA Sequence

ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMP/Cartilage oligomeric matrix protein Recombinant Rabbit mAb
BS48794-01 50 µL

COMP/Cartilage oligomeric matrix protein Recombinant Rabbit mAb

Sign In for Pricing
View Details
COMP/Cartilage oligomeric matrix protein Recombinant Rabbit mAb
BS48794-02 100 µL

COMP/Cartilage oligomeric matrix protein Recombinant Rabbit mAb

Sign In for Pricing
View Details
TRPM2 (Transient Receptor Potential Cation Channel Subfamily M Member 2, Estrogen Responsive Element Associated Gene 1, Estrogen-responsive Element-associated Gene 1 Protein, EREG1, KNP3, Long Transient Receptor Potential Channel 2, LTRPC 2, LTRPC2, LTRPC-2, MGC133383, NUDT9H, NUDT9L1, Putative Ca2+ Channel Protein, Transient Receptor Potential Channel 7, TRPC 7, TRPC7) discontinued
T8666-35F 50 µg

TRPM2 (Transient Receptor Potential Cation Channel Subfamily M Member 2, Estrogen Responsive Element Associated Gene 1, Estrogen-responsive Element-associated Gene 1 Protein, EREG1, KNP3, Long Transient Receptor Potential Channel 2, LTRPC 2, LTRPC2, LTRPC-2, MGC133383, NUDT9H, NUDT9L1, Putative Ca2+ Channel Protein, Transient Receptor Potential Channel 7, TRPC 7, TRPC7) discontinued

Sign In for Pricing
View Details
Dopamine Beta Hydroxylase, CT (DBH, Dopamine beta Monooxygenase, DBM) (AP) discontinued
D9010-02A-AP 100 µL

Dopamine Beta Hydroxylase, CT (DBH, Dopamine beta Monooxygenase, DBM) (AP) discontinued

Sign In for Pricing
View Details
Rat α-tubulin (α-tubulin) ELISA Kit
YP-W37512-01 48 Tests

Rat α-tubulin (α-tubulin) ELISA Kit

Sign In for Pricing
View Details
Rat α-tubulin (α-tubulin) ELISA Kit
YP-W37512-02 96 Tests

Rat α-tubulin (α-tubulin) ELISA Kit

Sign In for Pricing
View Details