Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS14 Rabbit pAb (APR28801N)

Product Specifications

Background

This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, through its GoLoco domain, to specific types of activated, GTP-bound G alpha subunits. Acting as a GTPase activating protein (GAP), the protein increases the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RGS14 Rabbit pAb (APR28801N) .

Synonyms

RGS14

Gene ID

10636

UniProt

O43566

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, PML body, centrosome, cytoskeleton, dendrite, dendritic spine, microtubule organizing center, postsynaptic cell membrane, postsynaptic density, spindle, spindle pole, synapse

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/36kDa/44kDa/61kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10636

Uniprot URL

https://www.uniprot.org/uniprot/O43566

AA Sequence

PPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Egg yolk emulsion, 50%
FD045F-100 mLX5VL 100 mL x 5 VL

Egg yolk emulsion, 50%

Ask
View Details
Sohlh2 siRNA Oligos set (Mouse)
45110174 3x 5 nmol

Sohlh2 siRNA Oligos set (Mouse)

Ask
View Details
RPS6KB2 Knockout Cell Lysate
ABC-KC1731 100 µg

RPS6KB2 Knockout Cell Lysate

Ask
View Details
IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG-49, IFI60, IFIT4, ISG60) (PE)
128251-PE 100 µL

IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG-49, IFI60, IFIT4, ISG60) (PE)

Ask
View Details
Lentiviral human GHSR shRNA (UAS) - Lentiviral human GHSR shRNA (UAS, iRFP) plasmid
GTR15309979 1 Vial

Lentiviral human GHSR shRNA (UAS) - Lentiviral human GHSR shRNA (UAS, iRFP) plasmid

Ask
View Details
Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP1A) ELISA Kit-Sandwich
EK3F356-01 48 Test

Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP1A) ELISA Kit-Sandwich

Ask
View Details