Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOBTB1 Rabbit pAb (APR28798N)

Product Specifications

Background

The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RHOBTB1 Rabbit pAb (APR28798N) .

Synonyms

RHOBTB1

Gene ID

9886

UniProt

O94844

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 79kDa Observed MW: 79kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9886

Uniprot URL

https://www.uniprot.org/uniprot/O94844

AA Sequence

PPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFAHRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSNKSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb
MBS8603694-01 0.1 mL

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb
MBS8603694-02 0.1 mL (AF405L)

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb
MBS8603694-03 0.1 mL (AF405S)

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb
MBS8603694-04 0.1 mL (AF610)

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb
MBS8603694-05 0.1 mL (AF635)

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb

Sign In for Pricing
View Details
Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb
MBS8603694-06 0.1 mL (APC)

Phospho-Elongation Factor 2 (Thr56/Thr58) Rabbit mAb

Sign In for Pricing
View Details