Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD72 Rabbit pAb (APR28769N)

Product Specifications

Background

B-Cell Differentiation Antigen CD72 (CD72) is a single-pass type II membrane protein. CD72 exists as a disulfide-linked homodimer and contains one C-type lectin domain. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 is a ligand for CD5. CD72 associates with CD5, interacts with PTPN6/SHP-1 and plays a role in B-cell proliferation and differentiation. CD72 associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP-1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD72 Rabbit pAb (APR28769N) .

Synonyms

CD72; CD72b; LYB2

Gene ID

971

UniProt

P21854

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=971

Uniprot URL

https://www.uniprot.org/uniprot/P21854

AA Sequence

QVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prss12 ORF Vector (Mouse) (pORF)
37831014 1.0 µg DNA

Prss12 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PTGDR2 Antibody
orb1239951-01 0.02 mg

PTGDR2 Antibody

Sign In for Pricing
View Details
PTGDR2 Antibody
orb1239951-02 0.1 mg

PTGDR2 Antibody

Sign In for Pricing
View Details
Recombinant Ricinus communis UPF0392 protein RCOM_0530710 (RCOM_0699480)
MBS1227931 Inquire

Recombinant Ricinus communis UPF0392 protein RCOM_0530710 (RCOM_0699480)

Sign In for Pricing
View Details
MAP2 Antibody
MBS8502511-01 0.1 mL

MAP2 Antibody

Sign In for Pricing
View Details
MAP2 Antibody
MBS8502511-02 0.1 mL (AF405L)

MAP2 Antibody

Sign In for Pricing
View Details