Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD72 Rabbit pAb (APR28769N)

Product Specifications

Background

B-Cell Differentiation Antigen CD72 (CD72) is a single-pass type II membrane protein. CD72 exists as a disulfide-linked homodimer and contains one C-type lectin domain. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 is a ligand for CD5. CD72 associates with CD5, interacts with PTPN6/SHP-1 and plays a role in B-cell proliferation and differentiation. CD72 associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP-1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD72 Rabbit pAb (APR28769N) .

Synonyms

CD72; CD72b; LYB2

Gene ID

971

UniProt

P21854

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:1000 - 1:4000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=971

Uniprot URL

https://www.uniprot.org/uniprot/P21854

AA Sequence

QVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dulbecco's Phosphate Buffered Saline (DPBS) with Calcium, Magnesium and Phenol Red
abx704732 500 mL

Dulbecco's Phosphate Buffered Saline (DPBS) with Calcium, Magnesium and Phenol Red

Sign In for Pricing
View Details
AccI (5 x 500 U)
JBS-EN-E2004-02 5x 500 U

AccI (5 x 500 U)

Sign In for Pricing
View Details
Cavy sCD163/Soluble Haemoglobin Scavenger Receptor ELISA Kit
MBS012354 Inquire

Cavy sCD163/Soluble Haemoglobin Scavenger Receptor ELISA Kit

Sign In for Pricing
View Details
CDC42EP4 (NM_012121) Human Over-expression Lysate
LY415972 100 µg

CDC42EP4 (NM_012121) Human Over-expression Lysate

Sign In for Pricing
View Details
GTF2F2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
22789124 3x 1.0µg DNA

GTF2F2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
FEZF1 Protein Vector (Rat) (pPM-C-HA)
20469026 500 ng

FEZF1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details