Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPR Rabbit pAb (APR28761N)

Product Specifications

Background

This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HPR Rabbit pAb (APR28761N) .

Synonyms

HPR; A-259H10.2; HP

Gene ID

3250

UniProt

P00739

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/43kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3250

Uniprot URL

https://www.uniprot.org/uniprot/P00739

AA Sequence

LYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2-fluoro-5-iodophenyl) propan-2-ol
PC1014207-01 250 mg

2- (2-fluoro-5-iodophenyl) propan-2-ol

Sign In for Pricing
View Details
2- (2-fluoro-5-iodophenyl) propan-2-ol
PC1014207-02 500 mg

2- (2-fluoro-5-iodophenyl) propan-2-ol

Sign In for Pricing
View Details
2- (2-fluoro-5-iodophenyl) propan-2-ol
PC1014207-03 1 g

2- (2-fluoro-5-iodophenyl) propan-2-ol

Sign In for Pricing
View Details
4-Chloro-4'-hydroxybenzophenone 98%
C13020 50 g

4-Chloro-4'-hydroxybenzophenone 98%

Sign In for Pricing
View Details
MORF4L1 (Mortality Factor 4 like 1, Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6) (AP)
MBS6165783-01 0.1 mL

MORF4L1 (Mortality Factor 4 like 1, Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6) (AP)

Sign In for Pricing
View Details
MORF4L1 (Mortality Factor 4 like 1, Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6) (AP)
MBS6165783-02 5x 0.1 mL

MORF4L1 (Mortality Factor 4 like 1, Eaf3, FWP006, HsT17725, MGC10631, MORFRG15, MRG15, S863-6) (AP)

Sign In for Pricing
View Details