Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS6 Rabbit pAb (APR28749N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPS6 Rabbit pAb (APR28749N) .

Synonyms

MRPS6; C21orf101; MRP-S6; RPMS6; S6mt

Gene ID

64968

UniProt

P82932

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64968

Uniprot URL

https://www.uniprot.org/uniprot/P82932

AA Sequence

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (Azide free) (HRP)
MBS6302615-01 0.2 mL

GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (Azide free) (HRP)

Sign In for Pricing
View Details
GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (Azide free) (HRP)
MBS6302615-02 5x 0.2 mL

GLRB, NT (GLRB, Glycine receptor subunit beta, Glycine receptor 58kD subunit) (Azide free) (HRP)

Sign In for Pricing
View Details
Human WBP5 knockdown cell line
ABC-KD16885 1 Vial

Human WBP5 knockdown cell line

Sign In for Pricing
View Details
PE-conjugated Anti-CCR8 (BMS 986340) mAb
MBS1880606-01 100 Tests

PE-conjugated Anti-CCR8 (BMS 986340) mAb

Sign In for Pricing
View Details
PE-conjugated Anti-CCR8 (BMS 986340) mAb
MBS1880606-02 5x 100 Tests

PE-conjugated Anti-CCR8 (BMS 986340) mAb

Sign In for Pricing
View Details
Human CD38 Protein, His & FLAG Tag
E40KMPH2366 20 µg

Human CD38 Protein, His & FLAG Tag

Sign In for Pricing
View Details