Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFR2 Rabbit pAb (APR28711N)

Product Specifications

Background

This gene encodes a single-pass type II membrane protein, which is a member of the transferrin receptor-like family. This protein mediates cellular uptake of transferrin-bound iron, and may be involved in iron metabolism, hepatocyte function and erythrocyte differentiation. Mutations in this gene have been associated with hereditary hemochromatosis type III. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Synonyms

TFR2; HFE3; TFRC2

Gene ID

7036

UniProt

Q9UP52

Cellular Locus

Cell membrane, Cytoplasm, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 69kDa/86kDa/88kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TFR2 Rabbit pAb (APR28711N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7036

Uniprot URL

https://www.uniprot.org/uniprot/Q9UP52

AA Sequence

AVEFSFMEDDQAYPFLHTKEDTYENLHKVLQGRLPAVAQAVAQLAGQLLIRLSHDRLLPLDFGRYGDVVLRHIGNLNEFSGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDERLTRMYNVRIMRVEFYFLSQYVSPADSPFRHIFMGRGDHTLGALLDHLRLLRSNSSGTPGATSSTGFQESRFRRQLALLTWTLQGAANALSGDVWNIDNNF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl
MBS6320030-01 0.1 mL

MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl

Ask
View Details
MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl
MBS6320030-02 5x 0.1 mL

MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl

Ask
View Details
Anti-Stat5a (phospho-S780) Antibody
A01087S780 100 µL

Anti-Stat5a (phospho-S780) Antibody

Ask
View Details
TJAP1, NT (TJAP1, PILT, TJP4, Tight junction-associated protein 1, Protein incorporated later into tight junctions, Tight junction protein 4) (MaxLight 550)
MBS6355708-01 0.1 mL

TJAP1, NT (TJAP1, PILT, TJP4, Tight junction-associated protein 1, Protein incorporated later into tight junctions, Tight junction protein 4) (MaxLight 550)

Ask
View Details
TJAP1, NT (TJAP1, PILT, TJP4, Tight junction-associated protein 1, Protein incorporated later into tight junctions, Tight junction protein 4) (MaxLight 550)
MBS6355708-02 5x 0.1 mL

TJAP1, NT (TJAP1, PILT, TJP4, Tight junction-associated protein 1, Protein incorporated later into tight junctions, Tight junction protein 4) (MaxLight 550)

Ask
View Details
Olfr631 siRNA Oligos set (Mouse)
33318174 3 x 5 nmol

Olfr631 siRNA Oligos set (Mouse)

Ask
View Details