Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Rabbit pAb (APR28682N)

Product Specifications

Background

This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GIPR Rabbit pAb (APR28682N) .

Synonyms

GIPR; PGQTL2

Gene ID

2696

UniProt

P48546

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/49kDa/53kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2696

Uniprot URL

https://www.uniprot.org/uniprot/P48546

AA Sequence

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6 Rabbit pAb
E45R17800N-50 50 µL

C6 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human NACHT and WD repeat domain-containing protein 1 (NWD1) , partial
MBS1298730 Inquire

Recombinant Human NACHT and WD repeat domain-containing protein 1 (NWD1) , partial

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit
MBS2708267-01 24 Strip Well

Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit
MBS2708267-02 48 Well

Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit
MBS2708267-03 96 Well

Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit
MBS2708267-04 5x 96 Well

Mouse Tumor Necrosis Factor Alpha (TNFa) Mini Samples ELISA Kit

Sign In for Pricing
View Details