Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Rabbit pAb (APR28682N)

Product Specifications

Background

This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GIPR Rabbit pAb (APR28682N) .

Synonyms

GIPR; PGQTL2

Gene ID

2696

UniProt

P48546

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/49kDa/53kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2696

Uniprot URL

https://www.uniprot.org/uniprot/P48546

AA Sequence

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Rat Forkhead Box Protein P2 (FOXP2) elisa Kit
QS1821Ra-01 48 Tests

Quick Step Rat Forkhead Box Protein P2 (FOXP2) elisa Kit

Sign In for Pricing
View Details
Quick Step Rat Forkhead Box Protein P2 (FOXP2) elisa Kit
QS1821Ra-02 96 Tests

Quick Step Rat Forkhead Box Protein P2 (FOXP2) elisa Kit

Sign In for Pricing
View Details
KRTAP3-2 Antibody, Biotin conjugated
CSB-PA871617LD01HU-01 50 µg

KRTAP3-2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
KRTAP3-2 Antibody, Biotin conjugated
CSB-PA871617LD01HU-02 100 µg

KRTAP3-2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
STON1 Conjugated Antibody
C34143 100 µL

STON1 Conjugated Antibody

Sign In for Pricing
View Details
FluxTip 10μL Extended-Length Filtered Pipet Tip
BHZ02B1W-FLS 10 µL

FluxTip 10μL Extended-Length Filtered Pipet Tip

Sign In for Pricing
View Details