Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB2 Rabbit pAb (APR28679N)

Product Specifications

Background

This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. They bind ligands called ephrins and are involved in diverse cellular processes including motility, division, and differentiation. A distinguishing characteristic of Eph-ephrin signaling is that both receptors and ligands are competent to transduce a signaling cascade, resulting in bidirectional signaling. This protein belongs to a subgroup of the Eph receptors called EphB. Proteins of this subgroup are distinguished from other members of the family by sequence homology and preferential binding affinity for membrane-bound ephrin-B ligands. Allelic variants are associated with prostate and brain cancer susceptibility. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EPHB2 Rabbit pAb (APR28679N) .

Synonyms

EPHB2; CAPB; DRT; EK5; EPHT3; ERK; Hek5; PCBC; Tyro5

Gene ID

2048

UniProt

P29323

Cellular Locus

Cell membrane, Cell projection, Single-pass type I membrane protein, axon, dendrite

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 109kDa/110kDa/117kDa Observed MW: 117kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2048

Uniprot URL

https://www.uniprot.org/uniprot/P29323

AA Sequence

PIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMRTA2 shRNA Plasmid (m)
sc-105303-SH 20 µg

DMRTA2 shRNA Plasmid (m)

Sign In for Pricing
View Details
TEP1 Polyclonal Antibody
E-AB-16092-01 20 µL

TEP1 Polyclonal Antibody

Sign In for Pricing
View Details
TEP1 Polyclonal Antibody
E-AB-16092-02 60 µL

TEP1 Polyclonal Antibody

Sign In for Pricing
View Details
TEP1 Polyclonal Antibody
E-AB-16092-03 120 µL

TEP1 Polyclonal Antibody

Sign In for Pricing
View Details
TEP1 Polyclonal Antibody
E-AB-16092-04 200 µL

TEP1 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Hibadh ELISA Kit
ELI-35175r 96 Tests

Rat Hibadh ELISA Kit

Sign In for Pricing
View Details