Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPXN Rabbit pAb (APR28669N)

Product Specifications

Background

The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by, tyrosine kinase activity. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LPXN Rabbit pAb (APR28669N) .

Synonyms

LPXN; LDPL; leupaxin

Gene ID

9404

UniProt

O60711

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Nucleus, focal adhesion, perinuclear region, podosome

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9404

Uniprot URL

https://www.uniprot.org/uniprot/O60711

AA Sequence

MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX1 Antibody - N-terminal region : HRP (P100957_P050-HRP)
P100957_P050-HRP 100 µL

OTX1 Antibody - N-terminal region : HRP (P100957_P050-HRP)

Sign In for Pricing
View Details
SCAMP3 Human qPCR Template Standard (NM_052837)
HK206535 1 Kit

SCAMP3 Human qPCR Template Standard (NM_052837)

Sign In for Pricing
View Details
C1orf198 siRNA (Human)
orb1854594-01 15 nmol

C1orf198 siRNA (Human)

Sign In for Pricing
View Details
C1orf198 siRNA (Human)
orb1854594-02 30 nmol

C1orf198 siRNA (Human)

Sign In for Pricing
View Details
CYP46A1 Rabbit pAb (APR28352N)
APR28352N-01 50 µL

CYP46A1 Rabbit pAb (APR28352N)

Sign In for Pricing
View Details
CYP46A1 Rabbit pAb (APR28352N)
APR28352N-02 100 µL

CYP46A1 Rabbit pAb (APR28352N)

Sign In for Pricing
View Details