Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP19 Rabbit pAb (APR28652N)

Product Specifications

Background

Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This protein is a ubiquitin protein ligase and plays a role in muscle wasting. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USP19 Rabbit pAb (APR28652N) .

Synonyms

USP19; ZMYND9

Gene ID

10869

UniProt

O94966

Cellular Locus

Endoplasmic reticulum membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 71kDa/140-156kDa Observed MW: 160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10869

Uniprot URL

https://www.uniprot.org/uniprot/O94966

AA Sequence

MSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGDPRKETGSRYVAQAGLEPLASGDPSASASHAAGITGSRHRTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPTPELLLDWRQSAEEVIVKLRVGVGPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTRKGSLLHLTLPKKVPMLTWPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Il17ra activation kit by CRISPRa
GA202129 1 Kit

Mouse Il17ra activation kit by CRISPRa

Sign In for Pricing
View Details
CD8a Mouse Monoclonal Antibody (SK1), CF®575 Conjugate - Biotium Choice
P009-575-500 1x 500 µL

CD8a Mouse Monoclonal Antibody (SK1), CF®575 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Human IL-1β (Interleukin 1 Beta) CLIA Kit
E-CL-H0141-01 24 Tests

Human IL-1β (Interleukin 1 Beta) CLIA Kit

Sign In for Pricing
View Details
Human IL-1β (Interleukin 1 Beta) CLIA Kit
E-CL-H0141-02 48 Tests

Human IL-1β (Interleukin 1 Beta) CLIA Kit

Sign In for Pricing
View Details
Human IL-1β (Interleukin 1 Beta) CLIA Kit
E-CL-H0141-03 96 Tests

Human IL-1β (Interleukin 1 Beta) CLIA Kit

Sign In for Pricing
View Details
ENO2 Antibody
KC-237-01 50 μL

ENO2 Antibody

Sign In for Pricing
View Details