Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2B Rabbit pAb (APR28650N)

Product Specifications

Background

This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with mental retardation. [provided by RefSeq, Jun 2016]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GATAD2B Rabbit pAb (APR28650N) .

Synonyms

GATAD2B; MRD18; P66beta; p68

Gene ID

57459

UniProt

Q8WXI9

Cellular Locus

Nucleus speckle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57459

Uniprot URL

https://www.uniprot.org/uniprot/Q8WXI9

AA Sequence

MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSV-G-tag Mouse Monoclonal Antibody [E0-G7]
M1510-10 100 µL

VSV-G-tag Mouse Monoclonal Antibody [E0-G7]

Sign In for Pricing
View Details
SHC2 Antibody
8C18733-AAT 50 µg

SHC2 Antibody

Sign In for Pricing
View Details
Mouse Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
RD-APAF1-Mu-01 96 Tests

Mouse Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
RD-APAF1-Mu-02 48 Tests

Mouse Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details
Human CTRP2 (C1QTNF2) activation kit by CRISPRa
GA114487 1 Kit

Human CTRP2 (C1QTNF2) activation kit by CRISPRa

Sign In for Pricing
View Details
RAE1 Rabbit Polyclonal Antibody
TA364955 100 µL

RAE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details