Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2B Rabbit pAb (APR28650N)

Product Specifications

Background

This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with mental retardation. [provided by RefSeq, Jun 2016]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GATAD2B Rabbit pAb (APR28650N) .

Synonyms

GATAD2B; MRD18; P66beta; p68

Gene ID

57459

UniProt

Q8WXI9

Cellular Locus

Nucleus speckle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57459

Uniprot URL

https://www.uniprot.org/uniprot/Q8WXI9

AA Sequence

MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNIP Recombinant Rabbit Monoclonal Antibody [JM60-35]
ET1705-72 100 µL

TXNIP Recombinant Rabbit Monoclonal Antibody [JM60-35]

Sign In for Pricing
View Details
Strept. Avidin Peroxidase Colloidal Gold, 1mL 30nm
HGA-02-30 1 mL

Strept. Avidin Peroxidase Colloidal Gold, 1mL 30nm

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF568 conjugate, 0.1mg/mL
BNC682786-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2786), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-1337-01 50 μL

IQGAP2 Antibody

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-1337-02 100 µL

IQGAP2 Antibody

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-1337-03 1 mL

IQGAP2 Antibody

Sign In for Pricing
View Details