Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD2B Rabbit pAb (APR28650N)

Product Specifications

Background

This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with mental retardation. [provided by RefSeq, Jun 2016]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GATAD2B Rabbit pAb (APR28650N) .

Synonyms

GATAD2B; MRD18; P66beta; p68

Gene ID

57459

UniProt

Q8WXI9

Cellular Locus

Nucleus speckle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57459

Uniprot URL

https://www.uniprot.org/uniprot/Q8WXI9

AA Sequence

MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tifa Mouse Gene Knockout Kit (CRISPR)
KN517561 1 Kit

Tifa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL
BNC942427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APPBP1 (NAE1) (C-term) Rabbit Polyclonal Antibody
AP13996PU-N 400 µL

APPBP1 (NAE1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ifnb1 Mouse Gene Knockout Kit (CRISPR)
KN308140LP 1 Kit

Ifnb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HEF1 (NEDD9) Mouse Monoclonal Antibody [Clone ID: OTI3H4]
CF809513 100 µg

HEF1 (NEDD9) Mouse Monoclonal Antibody [Clone ID: OTI3H4]

Sign In for Pricing
View Details
RNF36 (TRIM69) (NM_001301146) Human Tagged ORF Clone
RG237018 10 µg

RNF36 (TRIM69) (NM_001301146) Human Tagged ORF Clone

Sign In for Pricing
View Details