Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER Rabbit pAb (APR28645N)

Product Specifications

Background

The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FER Rabbit pAb (APR28645N) .

Synonyms

FER; PPP1R74; TYK3; p94-Fer

Gene ID

2241

UniProt

P16591

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Membrane, Nucleus, Peripheral membrane protein, cell cortex, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/74kDa/94kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2241

Uniprot URL

https://www.uniprot.org/uniprot/P16591

AA Sequence

YDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALSDMISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F5 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
CF810673 100 µg

E2F5 Mouse Monoclonal Antibody [Clone ID: OTI3B7]

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL
BNC040844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ITCH activation kit by CRISPRa
GA113254 1 Kit

Human ITCH activation kit by CRISPRa

Sign In for Pricing
View Details
Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]
AM31198PU-N 2 mL (200 Tests)

Fas Ligand (FASLG) Mouse Monoclonal Antibody [Clone ID: B-R17]

Sign In for Pricing
View Details
Recombinant Human CASK Kinase Protein (His & GST Tag)
PKSH030973 50 µg

Recombinant Human CASK Kinase Protein (His & GST Tag)

Sign In for Pricing
View Details
(+)-Biotin-ONP
TRC-B391605-50MG 50 mg

(+)-Biotin-ONP

Sign In for Pricing
View Details