Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER Rabbit pAb (APR28645N)

Product Specifications

Background

The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FER Rabbit pAb (APR28645N) .

Synonyms

FER; PPP1R74; TYK3; p94-Fer

Gene ID

2241

UniProt

P16591

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Membrane, Nucleus, Peripheral membrane protein, cell cortex, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/74kDa/94kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2241

Uniprot URL

https://www.uniprot.org/uniprot/P16591

AA Sequence

YDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALSDMISI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS503497 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human STEEP1 activation kit by CRISPRa
GA111924 1 Kit

Human STEEP1 activation kit by CRISPRa

Sign In for Pricing
View Details
AMOTL1 Antibody
8C14473-AAT 50 µg

AMOTL1 Antibody

Sign In for Pricing
View Details
Recombinant Human TIM-3/HAVCR2 Protein (His Tag)
PKSH033509-01 10 µg

Recombinant Human TIM-3/HAVCR2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TIM-3/HAVCR2 Protein (His Tag)
PKSH033509-02 50 µg

Recombinant Human TIM-3/HAVCR2 Protein (His Tag)

Sign In for Pricing
View Details
Human NEMP2 activation kit by CRISPRa
GA119140 1 Kit

Human NEMP2 activation kit by CRISPRa

Sign In for Pricing
View Details