Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytokeratin 12 (KRT12) Rabbit pAb (APR28636N)

Product Specifications

Background

KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cytokeratin 12 (KRT12) Rabbit pAb (APR28636N) .

Synonyms

KRT12; K12

Gene ID

3859

UniProt

Q99456

Dilution

WB 1:500 - 1:1000 IHC 1:20 - 1:50 FC 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa Observed MW: 53kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3859

Uniprot URL

https://www.uniprot.org/uniprot/Q99456

AA Sequence

TRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
MBS2035835-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
MBS2035835-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
MBS2035835-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
MBS2035835-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
MBS2035835-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)
MBS2035835-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Glial Cell Line Derived Neurotrophic Factor (GDNF)

Sign In for Pricing
View Details