Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP39 Rabbit pAb (APR28626N)

Product Specifications

Background

Plays a role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP, one of the building blocks of the precatalytic spliceosome. Regulates AURKB mRNA levels, and thereby plays a role in cytokinesis and in the spindle checkpoint. Does not have ubiquitin-specific peptidase activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality USP39 Rabbit pAb (APR28626N) .

Synonyms

USP39; 65K; CGI-21; HSPC332; SAD1; SNRNP65

Gene ID

10713

UniProt

Q53GS9

Cellular Locus

Nucleus

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 53kDa/56kDa/65kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10713

Uniprot URL

https://www.uniprot.org/uniprot/Q53GS9

AA Sequence

GTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) (MaxLight 650)
MBS6223925-01 0.1 mL

POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) (MaxLight 650)

Sign In for Pricing
View Details
POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) (MaxLight 650)
MBS6223925-02 5x 0.1 mL

POGK (KIAA1513, Pogo Transposable Element with KRAB Domain, LST003, SLTP003) (MaxLight 650)

Sign In for Pricing
View Details
ETNK2, NT (ETNK2, EKI2, Ethanolamine kinase 2, Ethanolamine kinase-like protein) (MaxLight 490)
MBS6296927-01 0.1 mL

ETNK2, NT (ETNK2, EKI2, Ethanolamine kinase 2, Ethanolamine kinase-like protein) (MaxLight 490)

Sign In for Pricing
View Details
ETNK2, NT (ETNK2, EKI2, Ethanolamine kinase 2, Ethanolamine kinase-like protein) (MaxLight 490)
MBS6296927-02 5x 0.1 mL

ETNK2, NT (ETNK2, EKI2, Ethanolamine kinase 2, Ethanolamine kinase-like protein) (MaxLight 490)

Sign In for Pricing
View Details
ZNF124 (Zinc Finger Protein 124, Zinc Finger Protein HZF-16, HZF16, ZK7) (MaxLight 550)
135593-ML550 100 µL

ZNF124 (Zinc Finger Protein 124, Zinc Finger Protein HZF-16, HZF16, ZK7) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human PAXBP1 shRNA (UAS) - Lentiviral human PAXBP1 shRNA (UAS, RFP) (100)
GTR15089052 1 Vial

Lentiviral human PAXBP1 shRNA (UAS) - Lentiviral human PAXBP1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details