What is the catalog number for SEC31A Rabbit pAb (APR28571N)?

The catalog number for SEC31A Rabbit pAb (APR28571N) is APR28571N.

What sizes are available for SEC31A Rabbit pAb (APR28571N)?

SEC31A Rabbit pAb (APR28571N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does SEC31A Rabbit pAb (APR28571N) come in?

SEC31A Rabbit pAb (APR28571N) is available in 3 different pack sizes.

Is SEC31A Rabbit pAb (APR28571N) in stock?

SEC31A Rabbit pAb (APR28571N) is currently made to order / not held in immediate stock. Contact us for lead time.

SEC31A Rabbit pAb (APR28571N)

Product Specifications

Background

The protein encoded by this gene shares similarity with the yeast Sec31 protein, and is a component of the outer layer of the coat protein complex II (COPII) . The encoded protein is involved in vesicle budding from the endoplasmic reticulum (ER) and contains multiple WD repeats near the N-terminus and a proline-rich region in the C-terminal half. It associates with the protein encoded by the SEC13 homolog, nuclear pore and COPII coat complex component (SEC13), and is required for ER-Golgi transport. Monoubiquitylation of this protein by CUL3-KLHL12 was found to regulate the size of COPII coats to accommodate unusually shaped cargo. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEC31A Rabbit pAb (APR28571N) .

Synonyms

SEC31A; ABP125; ABP130; HSPC275; HSPC334; SEC31L1

Gene ID

22872

UniProt

O94979

Cellular Locus

COPII-coated vesicle membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Peripheral membrane protein

Applications

IF (Sus scrofa)

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/105-134kDa Observed MW: 165kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22872

Uniprot URL

https://www.uniprot.org/uniprot/O94979

AA Sequence

PTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDL