Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC31A Rabbit pAb (APR28571N)

Product Specifications

Background

The protein encoded by this gene shares similarity with the yeast Sec31 protein, and is a component of the outer layer of the coat protein complex II (COPII) . The encoded protein is involved in vesicle budding from the endoplasmic reticulum (ER) and contains multiple WD repeats near the N-terminus and a proline-rich region in the C-terminal half. It associates with the protein encoded by the SEC13 homolog, nuclear pore and COPII coat complex component (SEC13), and is required for ER-Golgi transport. Monoubiquitylation of this protein by CUL3-KLHL12 was found to regulate the size of COPII coats to accommodate unusually shaped cargo. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SEC31A Rabbit pAb (APR28571N) .

Synonyms

SEC31A; ABP125; ABP130; HSPC275; HSPC334; SEC31L1

Gene ID

22872

UniProt

O94979

Cellular Locus

COPII-coated vesicle membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Peripheral membrane protein

Applications

IF (Sus scrofa)

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/105-134kDa Observed MW: 165kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22872

Uniprot URL

https://www.uniprot.org/uniprot/O94979

AA Sequence

PTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSIP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0817108 1.0 µg DNA

FSIP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Desmoglein-3 (Dsg3) Elisa Kit
EKC33444 96 Tests

Human Desmoglein-3 (Dsg3) Elisa Kit

Sign In for Pricing
View Details
EPS8L3 Peptide - middle region
orb1999823 100 µg

EPS8L3 Peptide - middle region

Sign In for Pricing
View Details
HIF-1α Mouse Monoclonal Antibody(Mix-mA)
RA10306-01 50 µL

HIF-1α Mouse Monoclonal Antibody(Mix-mA)

Sign In for Pricing
View Details
HIF-1α Mouse Monoclonal Antibody(Mix-mA)
RA10306-02 100 µL

HIF-1α Mouse Monoclonal Antibody(Mix-mA)

Sign In for Pricing
View Details
Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) BioAssayTM ECL ELISA Kit (Equine)
158137 96 Tests

Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) BioAssayTM ECL ELISA Kit (Equine)

Sign In for Pricing
View Details