Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNB4 Rabbit pAb (APR28568N)

Product Specifications

Background

This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME) . Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CACNB4 Rabbit pAb (APR28568N) .

Synonyms

CACNB4; CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6

Gene ID

785

UniProt

O00305

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/54kDa/56kDa/58kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=785

Uniprot URL

https://www.uniprot.org/uniprot/O00305

AA Sequence

ATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-23R ELISA Kit
EK5775 96 Tests

Mouse IL-23R ELISA Kit

Sign In for Pricing
View Details
HSF2BP AAV siRNA Pooled Vector
23962161 1.0 µg

HSF2BP AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Olfr1065 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
32556064 1.0 µg DNA

Olfr1065 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZNF577 Rabbit Polyclonal Antibody
TA345451 100 µL

ZNF577 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSMD2 (26S proteasome non-ATPase Regulatory Subunit 2, 26S proteasome Regulatory Subunit RPN1, 26S proteasome Regulatory Subunit S2, 26S proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-Associated Protein 2, PSMD2, TRAP2) discontinued
225311-01 50 µL

PSMD2 (26S proteasome non-ATPase Regulatory Subunit 2, 26S proteasome Regulatory Subunit RPN1, 26S proteasome Regulatory Subunit S2, 26S proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-Associated Protein 2, PSMD2, TRAP2) discontinued

Sign In for Pricing
View Details
PSMD2 (26S proteasome non-ATPase Regulatory Subunit 2, 26S proteasome Regulatory Subunit RPN1, 26S proteasome Regulatory Subunit S2, 26S proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-Associated Protein 2, PSMD2, TRAP2) discontinued
225311-02 100 µL

PSMD2 (26S proteasome non-ATPase Regulatory Subunit 2, 26S proteasome Regulatory Subunit RPN1, 26S proteasome Regulatory Subunit S2, 26S proteasome Subunit p97, Protein 55.11, Tumor Necrosis Factor Type 1 Receptor-Associated Protein 2, PSMD2, TRAP2) discontinued

Sign In for Pricing
View Details