Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11FIP1 Rabbit pAb (APR28540N)

Product Specifications

Background

This gene encodes one of the Rab11-family interacting proteins (Rab11-FIPs), which play a role in the Rab-11 mediated recycling of vesicles. The encoded protein may be involved in endocytic sorting, trafficking of proteins including integrin subunits and epidermal growth factor receptor (EGFR), and transport between the recycling endosome and the trans-Golgi network. Alternative splicing results in multiple transcript variants. A pseudogene is described on the X chromosome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAB11FIP1 Rabbit pAb (APR28540N) .

Synonyms

RAB11FIP1; NOEL1A; RCP; rab11-FIP1

Gene ID

80223

UniProt

Q6WKZ4

Cellular Locus

Cytoplasmic vesicle, Recycling endosome, phagosome membrane

Applications

WB (Homo sapiens) IP (Homo sapiens)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa/47kDa/65kDa/70kDa/137kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=80223

Uniprot URL

https://www.uniprot.org/uniprot/Q6WKZ4

AA Sequence

EAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin A1 (EFNA1) Rabbit Polyclonal Antibody
AP20378PU-N 100 µg

Ephrin A1 (EFNA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXO3 pSer253 Rabbit Polyclonal Antibody
AP20889PU-N 100 µg

FOXO3 pSer253 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF405S conjugate, 0.1mg/mL
BNC040024-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitamin K1 2,3-Epoxide (Mixture of Diastereomers)
TRC-V680013-50MG 50 mg

Vitamin K1 2,3-Epoxide (Mixture of Diastereomers)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708043 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
SRMS Human Gene Knockout Kit (CRISPR)
KN221920 1 Kit

SRMS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details