Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPL Rabbit pAb (APR28538N)

Product Specifications

Background

This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha) (8) -barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NPL Rabbit pAb (APR28538N) .

Synonyms

NPL; C112; C1orf13; NAL; NPL1

Gene ID

80896

UniProt

Q9BXD5

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/26kDa/31kDa/33kDa/35kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=80896

Uniprot URL

https://www.uniprot.org/uniprot/Q9BXD5

AA Sequence

MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANK2 Protein Vector (Human) (pPM-N-D-C-His)
PV321793 500 ng

ANK2 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Monkey Integrin alphaVbeta1 ELISA Kit
MBS7262904-01 48 Well

Monkey Integrin alphaVbeta1 ELISA Kit

Sign In for Pricing
View Details
Monkey Integrin alphaVbeta1 ELISA Kit
MBS7262904-02 96 Well

Monkey Integrin alphaVbeta1 ELISA Kit

Sign In for Pricing
View Details
Monkey Integrin alphaVbeta1 ELISA Kit
MBS7262904-03 5x 96 Well

Monkey Integrin alphaVbeta1 ELISA Kit

Sign In for Pricing
View Details
Monkey Integrin alphaVbeta1 ELISA Kit
MBS7262904-04 10x 96 Well

Monkey Integrin alphaVbeta1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Horse Cytochrome P450 19A1 (CYP19A1), partial
MBS1126744 Inquire

Recombinant Horse Cytochrome P450 19A1 (CYP19A1), partial

Sign In for Pricing
View Details