Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPL Rabbit pAb (APR28538N)

Product Specifications

Background

This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha) (8) -barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NPL Rabbit pAb (APR28538N) .

Synonyms

NPL; C112; C1orf13; NAL; NPL1

Gene ID

80896

UniProt

Q9BXD5

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/26kDa/31kDa/33kDa/35kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=80896

Uniprot URL

https://www.uniprot.org/uniprot/Q9BXD5

AA Sequence

MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Ethoxyphenylacetic acid
FE55015 5 g

2-Ethoxyphenylacetic acid

Sign In for Pricing
View Details
Brap (NM_028227) Mouse Tagged Lenti ORF Clone
MR217615L3 10 µg

Brap (NM_028227) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ITPK1 Polyclonal Antibody, HRP Conjugated
bs-17183R-HRP 100 µL

ITPK1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
RGAG1 Protein Vector (Mouse) (pPM-C-HA)
PV223772 500 ng

RGAG1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
BLMH (Bleomycin Hydrolase, BH, BLM Hydrolase, BMH) (MaxLight 490)
123945-ML490 100 µL

BLMH (Bleomycin Hydrolase, BH, BLM Hydrolase, BMH) (MaxLight 490)

Sign In for Pricing
View Details
HnRNP U (Heterogeneous nuclear ribonucleoprotein Upp120 p120 nuclear protein scaffold attachment factor A) discontinued. see 223348
143193 100 µL

HnRNP U (Heterogeneous nuclear ribonucleoprotein Upp120 p120 nuclear protein scaffold attachment factor A) discontinued. see 223348

Sign In for Pricing
View Details