Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WRNIP1 Rabbit pAb (APR28528N)

Product Specifications

Background

Werner's syndrome is a rare autosomal recessive disorder characterized by accelerated aging that is caused by defects in the Werner syndrome ATP-dependent helicase gene (WRN) . The protein encoded by this gene interacts with the exonuclease-containing N-terminal portion of the Werner protein. This protein has a ubiquitin-binding zinc-finger domain in the N-terminus, an ATPase domain, and two leucine zipper motifs in the C-terminus. It has sequence similarity to replication factor C family proteins and is conserved from E. coli to human. This protein likely accumulates at sites of DNA damage by interacting with polyubiquinated proteins and also binds to DNA polymerase delta and increases the initiation frequency of DNA polymerase delta-mediated DNA synthesis. This protein also interacts with nucleoporins at nuclear pore complexes. Two transcript variants encoding different isoforms have been isolated for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WRNIP1 Rabbit pAb (APR28528N) .

Synonyms

WRNIP1; WHIP; bA420G6.2

Gene ID

56897

UniProt

Q96S55

Cellular Locus

Nucleus

Dilution

WB 1:1000 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/49kDa/69kDa/72kDa Observed MW: 72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=56897

Uniprot URL

https://www.uniprot.org/uniprot/Q96S55

AA Sequence

DKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRELID3A (NM_001142406) Human Over-expression Lysate
E45H01758-2 20 µg

PRELID3A (NM_001142406) Human Over-expression Lysate

Sign In for Pricing
View Details
Rgr sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6739806 1.0 µg DNA

Rgr sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RPS27AP16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2055805 3x 1.0 µg

RPS27AP16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MEK1 Antibody: ATTO 488
MBS8001455-01 0.1 mg

MEK1 Antibody: ATTO 488

Sign In for Pricing
View Details
MEK1 Antibody: ATTO 488
MBS8001455-02 5x 0.1 mg

MEK1 Antibody: ATTO 488

Sign In for Pricing
View Details
Rat IgG2a Antibody Pair Set
E-KAB-0630 50 µL & 100 µg

Rat IgG2a Antibody Pair Set

Sign In for Pricing
View Details