Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2M Rabbit pAb (APR28484N)

Product Specifications

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2M Rabbit pAb (APR28484N) .

Synonyms

UBE2M; UBC-RS2; UBC12; hUbc12

Gene ID

9040

UniProt

P61081

Applications

WB (Homo sapiens)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9040

Uniprot URL

https://www.uniprot.org/uniprot/P61081

AA Sequence

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)
MBS1404560-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)
MBS1404560-02 0.1 mg (E-Coli)

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)
MBS1404560-03 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)
MBS1404560-04 0.1 mg (Yeast)

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)
MBS1404560-05 0.02 mg (Baculovirus)

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)
MBS1404560-06 0.02 mg (Mammalian-Cell)

Recombinant Burkholderia pseudomallei SsrA-binding protein (smpB)

Sign In for Pricing
View Details