Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Rabbit pAb (APR28482N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TFIP11 Rabbit pAb (APR28482N) .

Synonyms

TFIP11; NTR1; STIP; STIP-1; Spp382; TIP39; bK445C9.6; hNtr1

Gene ID

24144

UniProt

Q9UBB9

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:3000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/96kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=24144

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBB9

AA Sequence

MSLSHLYRDGEGRIDDDDDERENFEITDWDLQNEFNPNRQRHWQTKEEATYGVWAERDSDDERPSFGGKRARDYSAPVNFISAGLKKGAAEEAELEDSDDEEKPVKQDDFPKDFGPRKLKTGGNFKPSQKGFAGGTKSFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig B-Cell Activating Factor (BAFF/CD257) ELISA Kit
orb782106-01 48 Tests

Pig B-Cell Activating Factor (BAFF/CD257) ELISA Kit

Sign In for Pricing
View Details
Pig B-Cell Activating Factor (BAFF/CD257) ELISA Kit
orb782106-02 96 Tests

Pig B-Cell Activating Factor (BAFF/CD257) ELISA Kit

Sign In for Pricing
View Details
Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)
MBS1468800-01 0.02 mg (E-Coli)

Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)

Sign In for Pricing
View Details
Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)
MBS1468800-02 0.1 mg (E-Coli)

Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)

Sign In for Pricing
View Details
Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)
MBS1468800-03 0.02 mg (Yeast)

Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)

Sign In for Pricing
View Details
Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)
MBS1468800-04 0.1 mg (Yeast)

Recombinant Lonomia obliqua Translationally-controlled tumor protein homolog (Tctp)

Sign In for Pricing
View Details