Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HVCN1 Rabbit pAb (APR28472N)

Product Specifications

Background

This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HVCN1 Rabbit pAb (APR28472N) .

Synonyms

HVCN1; HV1; VSOP

Gene ID

84329

UniProt

Q96D96

Cellular Locus

Cell membrane, Membrane, Multi-pass membrane protein

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/29kDa/31kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84329

Uniprot URL

https://www.uniprot.org/uniprot/Q96D96

AA Sequence

MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COTL1 Mouse Monoclonal Antibody [Clone ID: 5C8]
AM06725PU-N 100 µg

COTL1 Mouse Monoclonal Antibody [Clone ID: 5C8]

Sign In for Pricing
View Details
ADFP/PLIN2 Recombinant Rabbit Monoclonal Antibody [JA31-81]
ET1704-17 100 µL

ADFP/PLIN2 Recombinant Rabbit Monoclonal Antibody [JA31-81]

Sign In for Pricing
View Details
10X Tris Buffered Saline (TBS) (1X Tris Buffered Saline, pH7.4), Ultra Pure Grade, 1L
PB1140-1L 1 L

10X Tris Buffered Saline (TBS) (1X Tris Buffered Saline, pH7.4), Ultra Pure Grade, 1L

Sign In for Pricing
View Details
CPT1B Mouse Monoclonal Antibody [Clone ID: OTI6B8]
CF810598 100 µg

CPT1B Mouse Monoclonal Antibody [Clone ID: OTI6B8]

Sign In for Pricing
View Details
16S V3-V5 Library Preparation Kit for Illumina (Set D)
70540 96 Preparations

16S V3-V5 Library Preparation Kit for Illumina (Set D)

Sign In for Pricing
View Details
Total Bilirubin (TBIL) Colorimetric Assay Kit
E-BC-K760-M-01 48 T (22 samples)

Total Bilirubin (TBIL) Colorimetric Assay Kit

Sign In for Pricing
View Details