Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NISCH Rabbit pAb (APR28466N)

Product Specifications

Background

This gene encodes a nonadrenergic imidazoline-1 receptor protein that localizes to the cytosol and anchors to the inner layer of the plasma membrane. The orthologous mouse protein has been shown to influence cytoskeletal organization and cell migration by binding to alpha-5-beta-1 integrin. In humans, this protein has been shown to bind to the adapter insulin receptor substrate 4 (IRS4) to mediate translocation of alpha-5 integrin from the cell membrane to endosomes. Expression of this protein was reduced in human breast cancers while its overexpression reduced tumor growth and metastasis; possibly by limiting the expression of alpha-5 integrin. In human cardiac tissue, this gene was found to affect cell growth and death while in neural tissue it affected neuronal growth and differentiation. Alternative splicing results in multiple transcript variants encoding differerent isoforms. Some isoforms lack the expected C-terminal domains of a functional imidazoline receptor.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NISCH Rabbit pAb (APR28466N) .

Synonyms

NISCH; I-1; IR1; IRAS; hIRAS; nischarin

Gene ID

11188

UniProt

Q9Y2I1

Cellular Locus

Cell membrane, Cytoplasm, Early endosome, Recycling endosome

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/63kDa/110kDa/166kDa Observed MW: 166kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11188

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y2I1

AA Sequence

SLPQPILSNQGIMFVQEEALASSLSSTDSLTPEHQPIAQGCSDSLESIPAGQAASDDLRDVPGAVGGASPEHAEPEVQVVPGSGQIIFLPFTCIGYTATNQDFIQRLSTLIRQAIERQLPAWIEAANQREEGQGEQGEEEDEEEEEEEDVAENRYFEMGPPDVEEEEGGGQGEEEEEEEEDEEAEEERLALEWALGADEDF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CA I Rabbit Polyclonal Antibody
E28PT0572 100 µL

CA I Rabbit Polyclonal Antibody

Ask
View Details
Gloves Rubber Knited Dotted
2110120/8 1 Each

Gloves Rubber Knited Dotted

Ask
View Details
TBCK (TBC Domain-containing Protein Kinase-like Protein, TBCKL, HSPC302, MGC16169) (FITC)
129625-FITC 100 µL

TBCK (TBC Domain-containing Protein Kinase-like Protein, TBCKL, HSPC302, MGC16169) (FITC)

Ask
View Details
Recombinant Bovine DNA replication complex GINS protein SLD5 (GINS4)
MBS1128912-01 0.02 mg (E-Coli)

Recombinant Bovine DNA replication complex GINS protein SLD5 (GINS4)

Ask
View Details
Recombinant Bovine DNA replication complex GINS protein SLD5 (GINS4)
MBS1128912-02 0.1 mg (E-Coli)

Recombinant Bovine DNA replication complex GINS protein SLD5 (GINS4)

Ask
View Details
Recombinant Bovine DNA replication complex GINS protein SLD5 (GINS4)
MBS1128912-03 0.02 mg (Yeast)

Recombinant Bovine DNA replication complex GINS protein SLD5 (GINS4)

Ask
View Details